Questions tagged [classification]

The process of sorting or arranging entities into groups or categories; on a map, the process of representing members of a group by the same symbol, usually defined in a legend.

Filter by
Sorted by
Tagged with
2
votes
0answers
35 views

Can I symbolize based on the syntax in a description attribute colum?

I got a kmz-file from an organization and the attribute table has a colum 'description' with a synthax that holds import information (such as date built, water source, village etc.) instead of a ...
1
vote
1answer
27 views

Merging NDVI classified and unsupervised classified image?

I have clipped forest area from an image and apply NDVI classification on forest area and in the remaining, I have done unsupervised classification. So, I want to know after NDVI and unsupervised ...
1
vote
0answers
47 views

Linear Regression on single image with multiple bands in Google Earth Engine

I have a single image with 3 bands representing different properties for water detection and a 4th band for reference (ground truth - water/no-water). I want to perform a linear regression using the 3 ...
4
votes
1answer
146 views

Setting GroundFilter parameters for low density point clouds?

I'd like to use the function GroundFilter on my dataset. However, the manual says that the default values of the parameters used by this function (g parameter, w parameter) are related to a high ...
-1
votes
1answer
66 views

Can my “.las” data be classified [duplicate]

I was given a ".las" data set from a Trimble/AutoCAD shop. I use Esri. I could not import the .las file they supplied to an ESRI LASDataset as it was created with Trimble software. I downloaded and ...
0
votes
0answers
35 views

Labeled training data for water extraction/classification [closed]

I'm working on a small project to extract water features from satellite images. In particular, I plan to use Landsat 7 ETM+ satellite images of a particular lake (it's on plain land). I have decided ...
4
votes
1answer
78 views

Get round numbers using Natural Breaks (Jenks) classification

In ArcMap, is there an easier way to get more round numbers when using the Natural Breaks (Jenks) classification in the symbology tab? For example, in the image ebelow I'd want the classes to be 5-140,...
0
votes
2answers
43 views

How can I find the percentage of representation of classes?

I have done a classification using the semi-automatic classification plugin, and now, I would like to express each class in percentage of the study area (e.g. forest represent 20% of the study area ...
1
vote
3answers
742 views

Determining if polygon lies completly in another polygon or only partly using QGIS? [closed]

I primarily use QGIS. I have two Layers which both contain polygons.So one layer(A) contains only one polygon, the other contains a number of polygons(layer (B)). I can run the Intersect-Tool and ...
4
votes
0answers
402 views

Running OTB Random Forest Classification

I am having trouble processing a satellite image using the RF (Random Forest) classification, that is a machine learning algorithm in the Orfeo Toolbox of QGis 2.18.1. When I run the Tool, the ...
0
votes
1answer
91 views

Earth engine error: Layer 1: Layer error: Image.visualize: Parameter 'image' is required

For land use classification of my shapefile, When I use Landsat 4 collection, got an error: Layer 1: Layer error: Image.visualize: Parameter 'image' is required. but in the case of Landsat 8, ...
1
vote
1answer
90 views

Can I use a greenest pixel or a no clouds Sentinel 2 for NDVI analysis?

Can I use a greenest pixel or a no clouds Sentinel 2 for NDVI analysis? I want to use it for extract spectral signature. And now that I´m asking about it, I want to know if I can work classification ...
0
votes
2answers
40 views

Calculation area of different colored region using image classification

I have a georeferenced JPEG image(as shown below) I want to calculate the area of regions covered by red color and regions covered by blue color. I tried maximum likelihood classification using ...
2
votes
2answers
102 views

Feature normalization (scaling) for Hyperspectral images

I have been straggling with the concept of feature normalization for the hyperspectral images. Respect to my problem I have attached a picture of my problem which clearly stands the issue which I have....
1
vote
0answers
36 views

Merging and Clustering Rasters using QGIS?

I have 3 rasters for three regionalized variables (r1, r2, r3). The rasters have the same projection, origin and cell spacing. Can I merge this into ONE "multivariate" raster? (ie x,y,r1,r2,r3) I ...
5
votes
1answer
143 views

QGIS Gratuated Symbology gives differents results on every classification with Natural Breaks (Jenks)

When styling a polygon layer using the Graduated styling and the Natural Breaks (Jenks) mode, QGIS is classifying the data with different values. So every time I click on "Classify" the values are ...
1
vote
1answer
44 views

Classifying fields and getting statistics in ArcMap? [duplicate]

I am using ArcMap 10.6. I have a table with country data. I am interested in Asia only, so I created a new layer (and shapefile). Several countries have missing data, which was filled with the same ...
0
votes
1answer
55 views

Exporting vector from raster classification gives deformed vector in Google Earth Engine?

I am very new with Google Earth Engine and I try to make a landcover classification using Sentinel-2 imagery to get the urban area over a very large area (country wide ideally). I was able to ...
2
votes
1answer
35 views

Supervised Classification in gvsig - fails repeatedly

I am teaching an ad hoc class in remote sensing, where students are bringing their own laptops I wanted to go over how to perform a supervised classification in the open source software I had chosen -...
1
vote
1answer
8 views

No visable Difference between two Lists for Visualisation via Palette creating an Error

I want to Visualize a Landcover Classification I have different success with seemingly identical Lists. List 1: Pallette Parameters inside the Code like: var landcoverPalette1 = [ 'E6004D', //...
14
votes
3answers
4k views

Distinction between pixel-based and object based classification?

I am struggling to clearly understand the distinction between pixel-based and object-based classification in the remote sensing domain and am hoping someone from this community can provide insight. ...
3
votes
2answers
410 views

Classify a slope raster in Image Analysis

I have a DEM in a Mosaic Dataset covering a large area (300 x 200 km). I want to create a classified slope raster showing slopes of say 0 - 10 degrees, 10 - 20 degrees, and then 20 - 90 degrees. ...
2
votes
1answer
61 views

How do duplicate script on Google Earth Engine code editor

I'm following https://docs.google.com/document/d/1bRCEB8ybRUp2D6vFc7mjqDMG2bpmCd2iTPQIEern0mk/edit#, its about classification and regression. I followed the regression part then I'll do the ...
0
votes
1answer
86 views

How can I collect training samples using ee.Image.sampleRegions() and an existing raster layer in Google Earth Engine?

I would like to sample training data from some raster data source (e.g. Sentinel-2) based on labels extracted from an already available dataset (e.g. some binary layer or classification map) in Google ...
0
votes
1answer
75 views

Running Maximum Likelihood Classification?

I'm trying to run a supervised classification on a landsat 8 (L8 OLI/TIRS COLLECTIONS LAND SURFACE REFLECTANCE ON-DEMAND) imagery. I created a signature file, then ran the Maximum Likelihood ...
2
votes
1answer
274 views

Calculate variable importance for classifications in Google Earth Engine

I am doing a simple Random Forest classification in Google Earth Engine. I try to classify upland, water and wetlands, using 25 variables derived from one year of Sentinel-1 images. The classifier ...
4
votes
1answer
142 views

What's the difference between sample, sampleRegions, and stratifiedSample in Google Earth Engine?

According to the documentation of GEE, ee.Image.sample() samples the pixels of an image and returns them as a FeatureCollection, in which each feature has 1 property per band in the input image. You ...
0
votes
1answer
327 views

How can ee.Image.stratifiedSample() be used in Google Earth Engine to select training samples for a binary classifier?

This is a follow-on question to How can one create a binary image from a FeatureCollection in Google Earth Engine? The corresponding minimal example can be found here: https://code.earthengine.google....
1
vote
1answer
66 views

Estimating building and vegetation volume with unclassified LiDAR datasets?

I'm trying to determine the ratio of building to vegetation change (i.e. how has the volume of built structures changed in proportion to the volume of vegetation) in a city over a period of five years....
2
votes
1answer
3k views

Computing unsupervised random forest classification in R?

I want to compute an unsupervised random forest classification out of a raster stack in R. The raster stack represents the same extent in different spectral bands and as a result I want to obtain an ...
1
vote
2answers
99 views

Image Classification on Photos From Camera?

I have some photos of 1X1 meter plots that were taken with a NIR digital camera. They have been georeferenced, corrected, etc. I am interested in performing an image classification for the vegetation,...
4
votes
0answers
99 views

Reproducing Paper Results for Land Cover Mapping of Satellite Imagery?

I am interested in training a neural network to perform pixel-based classification for land cover mapping of satellite data. In order to learn more about this interesting field I am trying to ...
1
vote
1answer
74 views

How to exclude some classes from legend?

I have a raster file with 8 classifications (all numerical), however the last classification I have coloured with 'no colour' so it does not show up on the map, however I also wish to exclude this ...
1
vote
2answers
376 views

Creating raster from several polygon layers using ArcGIS Desktop?

I have the following map: The four layers have the following attribute tables: SF_UrbanTreeCanopy_84 SF_Building_Footprints_84 GrassBeach Water I want to create a ...
0
votes
0answers
31 views

Classification using arcpy 2.7

I'm trying to create a tool that will consume National Weather Service 1 hour precipitation radar information and then classify groundcover based on amounts per area (in mm), then output the results ...
5
votes
1answer
226 views

black and white aerial ortophoto classification using texture with GRASS

I have a b&w image i want to classify; the trouble is that mere spectral classification yields a lot of error, I saw this in wikigrass In case of panchromatic maps or limited amount of channels,...
0
votes
1answer
162 views

Plot areas by class in a polygon with Google Earth Engine

I would like to plot the number of pixels or the area for each class contained in a polygon (shape of a country). I have found the ui.Chart.image.byClass function but I don't understand how to use it ...
2
votes
1answer
73 views

Sudden increase in the download size of images from GEE

I am working on LandSat 8 data to build a classifier for built up and non built up areas in a particular district. I was using the following code for classification and then to export my classified ...
0
votes
1answer
258 views

Slope Classification for HRU in a watershed (SWAT Model)

For the definition of HRU (Hydrological response units), the parameter slope can be classified into maximum of 5 classes. Depending on the definition the results will vary. Is there a commonly used ...
1
vote
0answers
289 views

Classifying image using image segmentation in google earth engine

I am trying to classify a Landsat 8 image in google earth engine. I have to classify them object based, since I am building on an earlier research where they have used object based classification. ...
3
votes
1answer
2k views

supervised classification

I am having a problem in creating new signatures in Signature Editor in ERDAS 2014. Whenever I click on the icon (i.e., after selecting the aoi), it shows an error which says "unable to open ...
3
votes
1answer
97 views

Performing Supervised Classification on Sentinel Image using ArcGIS Desktop?

Is it possible to perform supervised classification on Sentinel Satellite Image with the minimum error. I compared two raster, one being the manual classification of an area using Photoshop CS6 and ...
0
votes
0answers
75 views

PyQGIS 3.4: otb:unsupervisedkmeansimageclassification -> AttributeError: module 'processing' has no attribute 'runalg'

I'm trying to classify a raster with PyQGIS: import processing processing.runalg("otb:unsupervisedkmeansimageclassification","FalseColor.tif",128,None,100,3,1000,0.95,"class.tif",None) The python ...
2
votes
1answer
34 views

Presenting climate data over time?

I'm trying to map (using ArcMap 10.6.1) some climate change data and I'm not entirely sure how to classify the raster datasets. For this work I am focusing on four different climate change scenarios: ...
7
votes
1answer
148 views

How can I get a numerical (or value) display for equal intervals in a layer?

I'm looking to classify regions on a map by the amount of light pollution in the area. I have the varied intensities (0 through 60) plotted using a color map, but is there anyway that instead of a ...
0
votes
1answer
65 views

Visualize classes from shapefile attribute table

I have a shapefile with classification and I would like to see that map in QGIS. When I open it, adding it as layer, I just see the overall area filled with the shapes of the various classes but I ...
0
votes
2answers
984 views

Creating histogram/statistics/scatterplot by classification tool in ArcMap?

I'm currently working on a land cover classification with Landsat 8 imagery. I already subjected the imagery to pre-processing (atmospheric and topographic correction) and I mosaiced two images. Now I ...
0
votes
1answer
178 views

How can I access the different classes after I did a classification in Google Earth Engine

So I ran a Classification with Google Earth Engine, classifying forest and non-forest. After I prepared my ROI and declared some training points for each forest and non-forest (saved in the variable ...
1
vote
1answer
114 views

Static traffic visualization for certain streets with the help of historical traffic data, in QGIS? [closed]

The goal is to make a static map highlighting certain streets in a city that usually have high traffic (for example, highways and main roads). I am using OpenStreetMap for the city. The streets need ...
1
vote
1answer
142 views

Classify LAS By Height tool is not yielding any results?

The classify LAS by height tool (CLHT) in ArcGIS says that it will only reclassify LAS points with class codes of 0 or 1 (http://pro.arcgis.com/en/pro-app/tool-reference/3d-analyst/classify-las-by-...